PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00131.1_g00045.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family MYB
Protein Properties Length: 399aa    MW: 43847.8 Da    PI: 7.6614
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00131.1_g00045.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.32.7e-165297147
                             TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
          Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                             +g W+ eEd  l ++v+++G+++W++ ar ++ gR++k+c++rw + 
  Rsa1.0_00131.1_g00045.1 52 KGTWSREEDVMLSELVEKFGPRNWSSMARSIP-GRSGKSCRLRWCNQ 97
                             799*****************************.***********985 PP

2Myb_DNA-binding52.31.3e-16104146145
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                              r+++T+ Ede ++ a++ +G++ W+ Ia+ ++ gRt++ +k++w+
  Rsa1.0_00131.1_g00045.1 104 RNPFTEVEDEAIITAHAIHGNK-WSVIAKLLP-GRTDNAIKNHWN 146
                              789*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.6874798IPR017930Myb domain
SuperFamilySSF466896.74E-3050145IPR009057Homeodomain-like
SMARTSM007179.0E-1551100IPR001005SANT/Myb domain
PfamPF002491.0E-155297IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.5E-2353105IPR009057Homeodomain-like
CDDcd001671.80E-135496No hitNo description
PROSITE profilePS5129425.13299153IPR017930Myb domain
SMARTSM007172.6E-16103151IPR001005SANT/Myb domain
PfamPF002491.8E-14104146IPR001005SANT/Myb domain
CDDcd001673.00E-12106149No hitNo description
Gene3DG3DSA:1.10.10.603.5E-23106152IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009751Biological Processresponse to salicylic acid
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 399 aa     Download sequence    Send to blast
MEGEIWRRSE MTEKAVAVAG GRRYDDCGGA AAERFVGEGT SVGRRTRKKR IKGTWSREED  60
VMLSELVEKF GPRNWSSMAR SIPGRSGKSC RLRWCNQLDP SLKRNPFTEV EDEAIITAHA  120
IHGNKWSVIA KLLPGRTDNA IKNHWNATLR RRCTTDFETL RTTNTPTGNL VPQDSRFDRT  180
MNTTTTIASS EETLSSGGGG GFGGQVTTPL VSSDGKEATS MEISEEQCGD KANEEDISRQ  240
ECNNNDDPPT LFRPVAKLSS FNPYNHMGGS SSPHALNQNK FQSCKQDTAM LRLLEGAYSE  300
RFVPQKCGSA CCSNSPQKHS LLGPEFVDYL DPPTFPSYEL AAIATDISSL AWLRSGLESS  360
SVRAMEEAAG RLRPQGTTGH RDHCLVSEQG KSRTNALST
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C3e-365115357159MYB PROTO-ONCOGENE PROTEIN
1h89_C3e-365115357159MYB PROTO-ONCOGENE PROTEIN
1mse_C3e-36511523104C-Myb DNA-Binding Domain
1msf_C3e-36511523104C-Myb DNA-Binding Domain
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00337DAPTransfer from AT3G09230Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHQ6948270.0HQ694827.1 Brassica rapa var. purpuraria transcription factor MYB1 protein mRNA, complete cds.
GenBankHQ6948280.0HQ694828.1 Brassica rapa subsp. chinensis transcription factor MYB1 protein mRNA, complete cds.
GenBankKF9747500.0KF974750.1 Brassica napus MYB transcription factor 1 (MYB1.1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009123435.10.0PREDICTED: myb protein-like
TrEMBLF8SVR20.0F8SVR2_BRARC; Transcription factor MYB1 protein
TrEMBLM4EZ140.0M4EZ14_BRARP; Uncharacterized protein
STRINGBra034057.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM84922636
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G09230.11e-173myb domain protein 1